HORDB

ID: hor005606
Uniprot ID: P20394
Protein name: Exendin-3
Gene name: NA
Organism: Heloderma horridum horridum (Mexican beaded lizard)
Family: Glucagon family
Source: animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Heloderma horridum (species), Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0090729 toxin activity
GO BP: GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism
GO CC: GO:0005576 extracellular region

Sequence: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Length: 39(48-86)
Propeptide: MKIILWLCVFGLFLATLFPVSWQMPVESGLSSEDSASSESFASKIKRHSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSG
Signal peptide: MKIILWLCVFGLFLATLFPVS
Modification: T39 Serine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates vasoactive intestinal peptide (VIP) receptors in high concentrations (>100 nM), resulting in both an increase in cAMP and amylase secretion from pancreatic acini, although at low concentrations (between 0.3 and 3 nM) it increases cAMP without s
Mechanism: NA
Cross BBB: YES
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: 13卤3.2 minutes; /780 seconds ( PubMed ID: 11976797 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005606_AF2.pdb

hor005606_ESM.pdb

Mass:	488156	Formula:	C184H281N49O62S
Absent amino acids:	CY	Common amino acids:	S
pI:	4.38	Basic residues:	4
Polar residues:	13	Hydrophobic residues:	10
Hydrophobicity:	-70.26	Boman Index:	-7134
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	52.56
Instability Index:	6868.46	Extinction Coefficient cystines:	5500
Absorbance 280nm:	144.74

PubMed ID: 1700785
Title: Purification and structure of exendin-3, a new pancreatic secretagogue isolated from Heloderma horridum venom.
PubMed ID: 1704369
Title: Exendin-3, a novel peptide from Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor
PubMed ID: 19837656
Title:
PubMed ID: 20111963
Title:
PubMed ID: 11976797
Title: